Lineage for d1xi6a_ (1xi6 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570739Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2570740Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2570741Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2570750Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (5 species)
  7. 2570769Species Pyrococcus furiosus [TaxId:2261] [118191] (1 PDB entry)
    Uniprot Q8TZH9
  8. 2570770Domain d1xi6a_: 1xi6 A: [115347]
    Structural genomics target; PF2014

Details for d1xi6a_

PDB Entry: 1xi6 (more details), 2.8 Å

PDB Description: extragenic suppressor from pyrococcus furiosus pfu-1862794-001
PDB Compounds: (A:) extragenic suppressor

SCOPe Domain Sequences for d1xi6a_:

Sequence, based on SEQRES records: (download)

>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]}
klkfwrevaidiisdfettimpffgnpdggklvkispsgdetklvdklaedlilsritel
gvnvvseevgvidneseytvivdpldgsynfiagipffalslavfkkdkpiyaiiyepmt
erffegipgegaflngkrikvrktpdekpsisfysrgkgheivkhvkrtrtlgaialela
ylamgaldgvvdvrkyvrptdiaagtiiakeagalikdsagkdidisfnatdrldviavn
seellktil

Sequence, based on observed residues (ATOM records): (download)

>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]}
klkfwrevaidiisdfettimpffgnpdggklvklvdklaedlilsritelgvnvvseev
gvidneseytvivdpldgsynfiagipffalslavfkkdkpiyaiiyepmterffegipg
egaflngkrikvrksisfysrgkgheivkhvkrtrtlgaialelaylamgaldgvvdvrk
yvrptdiaagtiiakeagalikdsagkdidisfnatdrldviavnseellktil

SCOPe Domain Coordinates for d1xi6a_:

Click to download the PDB-style file with coordinates for d1xi6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xi6a_: