Lineage for d1xh3a1 (1xh3 A:182-276)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548583Species Human (Homo sapiens) [TaxId:9606] [88605] (76 PDB entries)
  8. 548588Domain d1xh3a1: 1xh3 A:182-276 [115287]
    Other proteins in same PDB: d1xh3a2, d1xh3b_

Details for d1xh3a1

PDB Entry: 1xh3 (more details), 1.48 Å

PDB Description: Conformational Restraints and Flexibility of 14-Meric Peptides in Complex with HLA-B*3501

SCOP Domain Sequences for d1xh3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xh3a1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1xh3a1:

Click to download the PDB-style file with coordinates for d1xh3a1.
(The format of our PDB-style files is described here.)

Timeline for d1xh3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xh3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xh3b_