SCOPe 2.01: Domain d1xg0d_: 1xg0 D:

Lineage for d1xg0d_ (1xg0 D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [46544] (3 PDB entries)
   Uniprot P27198

8. Domain d1xg0d_: 1xg0 D: [115276]
   Other proteins in same PDB: d1xg0a_, d1xg0b_
   complexed with cl, dbv, mg, peb

Details for d1xg0d_

PDB Entry: 1xg0, 0.97 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

PDB Compounds: (D:) B-phycoerythrin beta chain

SCOPe Domain Sequences for d1xg0d_:

Sequence; same for both SEQRES and ATOM records:

>d1xg0d_ a.1.1.3 (D:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Timeline for d1xg0d_:

• d1xg0d_ first appeared in SCOP 1.71
  
• d1xg0d_ appears in SCOP 1.75
  
• d1xg0d_ appears in SCOPe 2.02
  
• d1xg0d_ appears in the current release, SCOPe 2.08