SCOPe 2.01: Domain d1xg0b_: 1xg0 B:

Lineage for d1xg0b_ (1xg0 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
   not a true superfamily

5. Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
   consists of a long beta-hairpin and a single alpha-helix

6. Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)

7. Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries)
   Uniprot P30943 38-104 ! Uniprot Q00433 53-128

8. Domain d1xg0b_: 1xg0 B: [115274]
   Other proteins in same PDB: d1xg0c_, d1xg0d_
   complexed with cl, dbv, mg, peb

Details for d1xg0b_

PDB Entry: 1xg0, 0.97 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

PDB Compounds: (B:) Phycoerythrin alpha-2 chain

SCOPe Domain Sequences for d1xg0b_:

Sequence; same for both SEQRES and ATOM records:

>d1xg0b_ d.184.1.1 (B:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat
slakmtk

Timeline for d1xg0b_:

• d1xg0b_ first appeared in SCOP 1.71
  
• d1xg0b_ appears in SCOP 1.75
  
• d1xg0b_ appears in SCOPe 2.02
  
• d1xg0b_ appears in the current release, SCOPe 2.08