Lineage for d1xfoc2 (1xfo C:6-72,C:164-353)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838036Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 838193Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 838269Protein Frv operon protein FrvX, catalytic domain [117659] (1 species)
  7. 838270Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries)
    Uniprot O59196 # PH1527
  8. 838275Domain d1xfoc2: 1xfo C:6-72,C:164-353 [115270]
    Other proteins in same PDB: d1xfoa1, d1xfob1, d1xfoc1, d1xfod1

Details for d1xfoc2

PDB Entry: 1xfo (more details), 1.96 Å

PDB Description: Crystal Structure of an archaeal aminopeptidase
PDB Compounds: (C:) Frv operon protein FrvX

SCOP Domain Sequences for d1xfoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfoc2 c.56.5.4 (C:6-72,C:164-353) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
aahmdqiXwdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevg
lrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivr
wleelakkheipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvd
atvelmtkalenihelki

SCOP Domain Coordinates for d1xfoc2:

Click to download the PDB-style file with coordinates for d1xfoc2.
(The format of our PDB-style files is described here.)

Timeline for d1xfoc2: