Lineage for d1xfoc1 (1xfo C:73-163)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803679Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 803858Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 803859Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 803889Protein Frv operon protein FrvX [117239] (1 species)
  7. 803890Species Pyrococcus horikoshii [TaxId:53953] [117240] (3 PDB entries)
    Uniprot O59196 # PH1527
  8. 803895Domain d1xfoc1: 1xfo C:73-163 [115269]
    Other proteins in same PDB: d1xfoa2, d1xfob2, d1xfoc2, d1xfod2

Details for d1xfoc1

PDB Entry: 1xfo (more details), 1.96 Å

PDB Description: Crystal Structure of an archaeal aminopeptidase
PDB Compounds: (C:) Frv operon protein FrvX

SCOP Domain Sequences for d1xfoc1:

Sequence, based on SEQRES records: (download)

>d1xfoc1 b.49.3.1 (C:73-163) Frv operon protein FrvX {Pyrococcus horikoshii [TaxId: 53953]}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpphiqkpedrkk
apdwdqifidigaeskeeaedmgvkigtvit

Sequence, based on observed residues (ATOM records): (download)

>d1xfoc1 b.49.3.1 (C:73-163) Frv operon protein FrvX {Pyrococcus horikoshii [TaxId: 53953]}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdwdqifidi
gaeskeeaedmgvkigtvit

SCOP Domain Coordinates for d1xfoc1:

Click to download the PDB-style file with coordinates for d1xfoc1.
(The format of our PDB-style files is described here.)

Timeline for d1xfoc1: