Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Frv operon protein FrvX, catalytic domain [117659] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries) Uniprot O59196 # PH1527 |
Domain d1xfob2: 1xfo B:6-72,B:164-353 [115268] Other proteins in same PDB: d1xfoa1, d1xfob1, d1xfoc1, d1xfod1 complexed with zn |
PDB Entry: 1xfo (more details), 1.96 Å
SCOPe Domain Sequences for d1xfob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfob2 c.56.5.4 (B:6-72,B:164-353) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi aahmdqiXwdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevg lrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivr wleelakkheipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvd atvelmtkalenihelki
Timeline for d1xfob2: