Lineage for d1xfob2 (1xfo B:6-72,B:164-353)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587177Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 587552Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 587640Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (12 proteins)
  6. 587669Protein Frv operon protein FrvX, catalytic domain [117659] (1 species)
  7. 587670Species Pyrococcus horikoshii [TaxId:70601] [117660] (1 PDB entry)
  8. 587672Domain d1xfob2: 1xfo B:6-72,B:164-353 [115268]
    Other proteins in same PDB: d1xfoa1, d1xfob1, d1xfoc1, d1xfod1

Details for d1xfob2

PDB Entry: 1xfo (more details), 1.96 Å

PDB Description: Crystal Structure of an archaeal aminopeptidase

SCOP Domain Sequences for d1xfob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfob2 c.56.5.4 (B:6-72,B:164-353) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii}
mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
aahmdqiXwdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevg
lrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivr
wleelakkheipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvd
atvelmtkalenihelki

SCOP Domain Coordinates for d1xfob2:

Click to download the PDB-style file with coordinates for d1xfob2.
(The format of our PDB-style files is described here.)

Timeline for d1xfob2: