Lineage for d1xfoa1 (1xfo A:73-163)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562925Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 562926Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (4 proteins)
  6. 562927Protein Frv operon protein FrvX [117239] (1 species)
  7. 562928Species Pyrococcus horikoshii [TaxId:70601] [117240] (1 PDB entry)
  8. 562929Domain d1xfoa1: 1xfo A:73-163 [115265]
    Other proteins in same PDB: d1xfoa2, d1xfob2, d1xfoc2, d1xfod2

Details for d1xfoa1

PDB Entry: 1xfo (more details), 1.96 Å

PDB Description: Crystal Structure of an archaeal aminopeptidase

SCOP Domain Sequences for d1xfoa1:

Sequence, based on SEQRES records: (download)

>d1xfoa1 b.49.3.1 (A:73-163) Frv operon protein FrvX {Pyrococcus horikoshii}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpphiqkpedrkk
apdwdqifidigaeskeeaedmgvkigtvit

Sequence, based on observed residues (ATOM records): (download)

>d1xfoa1 b.49.3.1 (A:73-163) Frv operon protein FrvX {Pyrococcus horikoshii}
glmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdwdqifidi
gaeskeeaedmgvkigtvit

SCOP Domain Coordinates for d1xfoa1:

Click to download the PDB-style file with coordinates for d1xfoa1.
(The format of our PDB-style files is described here.)

Timeline for d1xfoa1: