Lineage for d1xedd_ (1xed D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931470Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)
  7. 931471Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
    Uniprot P01833 20-127 # N-terminal, ligand-binding domain
  8. 931475Domain d1xedd_: 1xed D: [115232]
    complexed with mg

Details for d1xedd_

PDB Entry: 1xed (more details), 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR
PDB Compounds: (D:) Polymeric-immunoglobulin receptor

SCOPe Domain Sequences for d1xedd_:

Sequence, based on SEQRES records: (download)

>d1xedd_ b.1.1.1 (D:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskyag
ranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Sequence, based on observed residues (ATOM records): (download)

>d1xedd_ b.1.1.1 (D:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

SCOPe Domain Coordinates for d1xedd_:

Click to download the PDB-style file with coordinates for d1xedd_.
(The format of our PDB-style files is described here.)

Timeline for d1xedd_: