Lineage for d1xdvb1 (1xdv B:200-404)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719615Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. 2719616Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
    Uniprot Q07889 189-1046
  8. 2719619Domain d1xdvb1: 1xdv B:200-404 [115183]
    Other proteins in same PDB: d1xdva2, d1xdva3, d1xdvb2, d1xdvb3

Details for d1xdvb1

PDB Entry: 1xdv (more details), 4.1 Å

PDB Description: Experimentally Phased Structure of Human the Son of Sevenless protein at 4.1 Ang.
PDB Compounds: (B:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xdvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdvb1 a.87.1.1 (B:200-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
llnvqsgmekicskslakrrlsesa

SCOPe Domain Coordinates for d1xdvb1:

Click to download the PDB-style file with coordinates for d1xdvb1.
(The format of our PDB-style files is described here.)

Timeline for d1xdvb1: