Lineage for d1xdsb1 (1xds B:10-101)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906764Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 906765Protein Aclacinomycin-10-hydroxylase RdmB [101035] (1 species)
    evolved a different function; binds SAM and SAH
  7. 906766Species Streptomyces purpurascens [TaxId:1924] [101036] (4 PDB entries)
    Uniprot Q54527
  8. 906770Domain d1xdsb1: 1xds B:10-101 [115176]
    Other proteins in same PDB: d1xdsa2, d1xdsb2
    complexed with dra, sam

Details for d1xdsb1

PDB Entry: 1xds (more details), 2.3 Å

PDB Description: Crystal structure of Aclacinomycin-10-hydroxylase (RdmB) in complex with S-adenosyl-L-methionine (SAM) and 11-deoxy-beta-rhodomycin (DbrA)
PDB Compounds: (B:) Protein RdmB

SCOPe Domain Sequences for d1xdsb1:

Sequence, based on SEQRES records: (download)

>d1xdsb1 a.4.5.29 (B:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekqgrplrptrlgmlladg

Sequence, based on observed residues (ATOM records): (download)

>d1xdsb1 a.4.5.29 (B:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhlladrtdthpqalsrlvrhltvvgv
leggerplrptrlgmlladg

SCOPe Domain Coordinates for d1xdsb1:

Click to download the PDB-style file with coordinates for d1xdsb1.
(The format of our PDB-style files is described here.)

Timeline for d1xdsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xdsb2