Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins) |
Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117012] (1 PDB entry) Uniprot P22605 209-453 |
Domain d1xdkf_: 1xdk F: [115167] Other proteins in same PDB: d1xdka_, d1xdke_ complexed with rea |
PDB Entry: 1xdk (more details), 2.9 Å
SCOP Domain Sequences for d1xdkf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdkf_ a.123.1.1 (F:) Retinoic acid receptor beta (RAR-beta) {Mouse (Mus musculus) [TaxId: 10090]} aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe pltps
Timeline for d1xdkf_: