SCOPe 2.08: Domain d1xd4b1: 1xd4 B:200-404

Lineage for d1xd4b1 (1xd4 B:200-404)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein Son of sevenless-1 (sos-1) [48067] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
   Uniprot Q07889 189-1046

8. Domain d1xd4b1: 1xd4 B:200-404 [115152]
   Other proteins in same PDB: d1xd4a2, d1xd4a3, d1xd4b2, d1xd4b3

Details for d1xd4b1

PDB Entry: 1xd4, 3.64 Å

PDB Description: crystal structure of the dh-ph-cat module of son of sevenless (sos)

PDB Compounds: (B:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xd4b1:

Sequence; same for both SEQRES and ATOM records:

>d1xd4b1 a.87.1.1 (B:200-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
llnvqsgmekicskslakrrlsesa

Timeline for d1xd4b1:

• d1xd4b1 first appeared in SCOP 1.71
  
• d1xd4b1 appears in SCOPe 2.07