Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (16 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (2 proteins) |
Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries) |
Domain d1xd3c_: 1xd3 C: [115147] Other proteins in same PDB: d1xd3b_, d1xd3d_ complexed with gve, mg |
PDB Entry: 1xd3 (more details), 1.45 Å
SCOP Domain Sequences for d1xd3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xd3c_ d.3.1.6 (C:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]} qrwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekye vfrteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfl eesvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyel dgrkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa
Timeline for d1xd3c_: