SCOP 1.73: Domain d1xd3c_: 1xd3 C:

Lineage for d1xd3c_ (1xd3 C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (2 proteins)

6. Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54052] (2 PDB entries)

8. Domain d1xd3c_: 1xd3 C: [115147]
   Other proteins in same PDB: d1xd3b_, d1xd3d_
   complexed with gve, mg

Details for d1xd3c_

PDB Entry: 1xd3, 1.45 Å

PDB Description: Crystal structure of UCHL3-UbVME complex

PDB Compounds: (C:) Ubiquitin Carboxyl-terminal esterase L3

SCOP Domain Sequences for d1xd3c_:

Sequence; same for both SEQRES and ATOM records:

>d1xd3c_ d.3.1.6 (C:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]}
qrwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekye
vfrteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfl
eesvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyel
dgrkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa

Timeline for d1xd3c_:

• d1xd3c_ first appeared in SCOP 1.71
  
• d1xd3c_ appears in SCOP 1.75
  
• d1xd3c_ appears in the current release, SCOPe 2.08