SCOPe 2.03: Domain d1xd2a_: 1xd2 A:

Lineage for d1xd2a_ (1xd2 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (100 PDB entries)
   Uniprot Q6P716

8. Domain d1xd2a_: 1xd2 A: [115142]
   Other proteins in same PDB: d1xd2c_
   complexed with gdp, mg, po4

Details for d1xd2a_

PDB Entry: 1xd2, 2.7 Å

PDB Description: crystal structure of a ternary ras:sos:ras*gdp complex

PDB Compounds: (A:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1xd2a_:

Sequence; same for both SEQRES and ATOM records:

>d1xd2a_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d1xd2a_:

• d1xd2a_ first appeared in SCOP 1.71
  
• d1xd2a_ appears in SCOPe 2.02
  
• d1xd2a_ appears in SCOPe 2.04
  
• d1xd2a_ appears in the current release, SCOPe 2.08