SCOP 1.71: Domain d1xcwa1: 1xcw A:404-496

Lineage for d1xcwa1 (1xcw A:404-496)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (27 PDB entries)

8. Domain d1xcwa1: 1xcw A:404-496 [115134]
   Other proteins in same PDB: d1xcwa2
   complexed with 3sa, ca, cl, nag

Details for d1xcwa1

PDB Entry: 1xcw, 2 Å

PDB Description: acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts

SCOP Domain Sequences for d1xcwa1:

Sequence; same for both SEQRES and ATOM records:

>d1xcwa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1xcwa1:

• d1xcwa1 is new in SCOP 1.71
  
• d1xcwa1 appears in SCOP 1.73
  
• d1xcwa1 appears in the current release, SCOPe 2.08