Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoA [52612] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries) Uniprot P61586 2-181 |
Domain d1xcgf_: 1xcg F: [115125] Other proteins in same PDB: d1xcga1, d1xcga2, d1xcge1, d1xcge2 |
PDB Entry: 1xcg (more details), 2.5 Å
SCOPe Domain Sequences for d1xcgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcgf_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]} airkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtag qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
Timeline for d1xcgf_: