Lineage for d1xc3a2 (1xc3 A:119-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884593Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 2884628Protein Putative fructokinase YhdR [117642] (1 species)
  7. 2884629Species Bacillus subtilis [TaxId:1423] [117643] (4 PDB entries)
    Uniprot O05510
  8. 2884637Domain d1xc3a2: 1xc3 A:119-294 [115103]
    Other proteins in same PDB: d1xc3a3
    Structural genomics target
    complexed with gol, pt, zn

Details for d1xc3a2

PDB Entry: 1xc3 (more details), 2.1 Å

PDB Description: structure of a putative fructokinase from bacillus subtilis
PDB Compounds: (A:) Putative fructokinase

SCOPe Domain Sequences for d1xc3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc3a2 c.55.1.10 (A:119-294) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]}
gldsclyitigtgigagaivegrllqglshpemghiyirrhpddvyqgkcpyhgdcfegl
asgpaiearwgkkaadlsdiaqvwelegyyiaqalaqyililapkkiilgggvmqqkqvf
syiyqyvpkimnsyldfselsddisdyivpprlgsnagiigtlvlahqalqaeaas

SCOPe Domain Coordinates for d1xc3a2:

Click to download the PDB-style file with coordinates for d1xc3a2.
(The format of our PDB-style files is described here.)

Timeline for d1xc3a2: