SCOP 1.71: Domain d1xc2a2: 1xc2 A:1-152

Lineage for d1xc2a2 (1xc2 A:1-152)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Pyrroline-5-carboxylate reductase ProC [117434] (1 species)

7. Species Neisseria meningitidis, serogroup B [TaxId:487] [117435] (1 PDB entry)

8. Domain d1xc2a2: 1xc2 A:1-152 [115101]
   Other proteins in same PDB: d1xc2a1
   Structural genomics target
   complexed with pro

Details for d1xc2a2

PDB Entry: 1xc2, 1.9 Å

PDB Description: Crystal Structure of a Pyrroline-5-Carboxylate Reductase from Neisseria meningitides MC58

SCOP Domain Sequences for d1xc2a2:

Sequence; same for both SEQRES and ATOM records:

>d1xc2a2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B}
mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddv
lilavkpqdmeaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglg
vsgmyaeaevsetdrriadrimksvgltvwld

Timeline for d1xc2a2:

• d1xc2a2 is new in SCOP 1.71
  
• d1xc2a2 last appears in SCOP 1.73