Lineage for d1xbaa_ (1xba A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931488Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 1931489Species Human (Homo sapiens) [TaxId:9606] [118132] (52 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 1931513Domain d1xbaa_: 1xba A: [115076]
    Structural genomics target

Details for d1xbaa_

PDB Entry: 1xba (more details), 2 Å

PDB Description: crystal structure of apo syk tyrosine kinase domain
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d1xbaa_:

Sequence, based on SEQRES records: (download)

>d1xbaa_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvne

Sequence, based on observed residues (ATOM records): (download)

>d1xbaa_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmvvktvavkilpalkdellaeanvmqqldnp
yivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnf
vhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfs
sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
ydvenrpgfaavelrlrnyyydvvne

SCOPe Domain Coordinates for d1xbaa_:

Click to download the PDB-style file with coordinates for d1xbaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xbaa_: