Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (2 PDB entries) |
Domain d1xb2a3: 1xb2 A:56-250 [115056] Other proteins in same PDB: d1xb2a1, d1xb2a2, d1xb2b1, d1xb2b2, d1xb2b3 |
PDB Entry: 1xb2 (more details), 2.2 Å
SCOP Domain Sequences for d1xb2a3:
Sequence, based on SEQRES records: (download)
>d1xb2a3 c.37.1.8 (A:56-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial} phvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahvey staarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigveh vvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglks vqklldavdtyipvp
>d1xb2a3 c.37.1.8 (A:56-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial} phvnvgtighvdhgkttltaaitkilaehveystaarhyahtdcpghadyvknmitgtap ldgcilvvaandgpmpqtrehlllarqigvehvvvyvnkadavqdsemvelveleirell tefgykgeetpiivgsalcaleqrdpelglksvqklldavdtyipvp
Timeline for d1xb2a3: