Lineage for d1xb2a2 (1xb2 A:349-452)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544755Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1544784Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (2 PDB entries)
    Uniprot P49410 56-452
  8. 1544789Domain d1xb2a2: 1xb2 A:349-452 [115055]
    Other proteins in same PDB: d1xb2a1, d1xb2a3, d1xb2b1, d1xb2b2, d1xb2b3

Details for d1xb2a2

PDB Entry: 1xb2 (more details), 2.2 Å

PDB Description: Crystal Structure of Bos taurus mitochondrial Elongation Factor Tu/Ts Complex
PDB Compounds: (A:) Elongation factor Tu, mitochondrial

SCOPe Domain Sequences for d1xb2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb2a2 b.44.1.1 (A:349-452) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]}
hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl
ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikws

SCOPe Domain Coordinates for d1xb2a2:

Click to download the PDB-style file with coordinates for d1xb2a2.
(The format of our PDB-style files is described here.)

Timeline for d1xb2a2: