Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50453] (2 PDB entries) Uniprot P49410 56-452 |
Domain d1xb2a1: 1xb2 A:251-348 [115054] Other proteins in same PDB: d1xb2a2, d1xb2a3, d1xb2b1, d1xb2b2, d1xb2b3 |
PDB Entry: 1xb2 (more details), 2.2 Å
SCOPe Domain Sequences for d1xb2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb2a1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} trdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfh ksldraeagdnlgalvrglkredlrrglvmakpgsiqp
Timeline for d1xb2a1: