Lineage for d1xaua_ (1xau A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 550483Family b.1.1.4: I set domains [49159] (34 proteins)
  6. 550490Protein B and T lymphocyte attenuator, Btla [117041] (1 species)
  7. 550491Species Mouse (Mus musculus) [TaxId:10090] [117042] (1 PDB entry)
  8. 550492Domain d1xaua_: 1xau A: [115041]
    complexed with cd

Details for d1xaua_

PDB Entry: 1xau (more details), 1.8 Å

PDB Description: structure of the btla ectodomain

SCOP Domain Sequences for d1xaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus)}
cevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvplevgpqlytswe
enrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvr

SCOP Domain Coordinates for d1xaua_:

Click to download the PDB-style file with coordinates for d1xaua_.
(The format of our PDB-style files is described here.)

Timeline for d1xaua_: