Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries) |
Domain d1xarb_: 1xar B: [115040] includes extra N-terminal oligomerisation helix (251-265) complexed with na |
PDB Entry: 1xar (more details), 2.25 Å
SCOP Domain Sequences for d1xarb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xarb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)} eltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeq nflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefs gsgwndnrcdvdnywickkpaacf
Timeline for d1xarb_: