SCOP 1.71: Domain d1xarb_: 1xar B:

Lineage for d1xarb_ (1xar B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)

8. Domain d1xarb_: 1xar B: [115040]
   includes extra N-terminal oligomerisation helix (251-265)
   complexed with na

Details for d1xarb_

PDB Entry: 1xar, 2.25 Å

PDB Description: Crystal Structure of a fragment of DC-SIGNR (containing the carbohydrate recognition domain and two repeats of the neck).

SCOP Domain Sequences for d1xarb_:

Sequence; same for both SEQRES and ATOM records:

>d1xarb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
eltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeq
nflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefs
gsgwndnrcdvdnywickkpaacf

Timeline for d1xarb_:

• d1xarb_ is new in SCOP 1.71
  
• d1xarb_ appears in SCOP 1.73
  
• d1xarb_ appears in the current release, SCOPe 2.08