Lineage for d1xarb_ (1xar B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614364Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. 614365Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)
  8. 614375Domain d1xarb_: 1xar B: [115040]
    includes extra N-terminal oligomerisation helix (251-265)
    complexed with na

Details for d1xarb_

PDB Entry: 1xar (more details), 2.25 Å

PDB Description: Crystal Structure of a fragment of DC-SIGNR (containing the carbohydrate recognition domain and two repeats of the neck).

SCOP Domain Sequences for d1xarb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xarb_ d.169.1.1 (B:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens)}
eltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeq
nflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefs
gsgwndnrcdvdnywickkpaacf

SCOP Domain Coordinates for d1xarb_:

Click to download the PDB-style file with coordinates for d1xarb_.
(The format of our PDB-style files is described here.)

Timeline for d1xarb_:

Domains from other chains:
(mouse over for more information)
d1xara_