Lineage for d1xara_ (1xar A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69858] (3 PDB entries)
    Uniprot Q9NNX6 219-397
  8. 1442597Domain d1xara_: 1xar A: [115039]
    includes extra N-terminal oligomerisation helix (251-265)
    complexed with na

Details for d1xara_

PDB Entry: 1xar (more details), 2.25 Å

PDB Description: Crystal Structure of a fragment of DC-SIGNR (containing the carbohydrate recognition domain and two repeats of the neck).
PDB Compounds: (A:) CD209 antigen-like protein 1

SCOPe Domain Sequences for d1xara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xara_ d.169.1.1 (A:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
yqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktae
eqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcae
fsgsgwndnrcdvdnywickkpaacf

SCOPe Domain Coordinates for d1xara_:

Click to download the PDB-style file with coordinates for d1xara_.
(The format of our PDB-style files is described here.)

Timeline for d1xara_: