Class b: All beta proteins [48724] (180 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein B. subtilis YhfP homologue [117169] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [117170] (1 PDB entry) Uniprot Q5L022; 96% sequence identity; Geobacillus kaustophilus TaxID:1462 |
Domain d1xa0a1: 1xa0 A:1-118,A:295-328 [115021] Other proteins in same PDB: d1xa0a2, d1xa0b2 Structural genomics target complexed with cl, so4 |
PDB Entry: 1xa0 (more details), 2.8 Å
SCOPe Domain Sequences for d1xa0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkgXl eriaqeislaelpqalkrilrgelrgrtvvrla
Timeline for d1xa0a1: