Lineage for d1x9sa1 (1x9s A:1-210)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586884Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
    contains Pfam 00929
  6. 586989Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 586990Species Bacteriophage T7 [TaxId:10760] [53124] (15 PDB entries)
  8. 587004Domain d1x9sa1: 1x9s A:1-210 [115005]
    Other proteins in same PDB: d1x9sa2, d1x9sb_
    complexed with 2dt, mg; mutant

Details for d1x9sa1

PDB Entry: 1x9s (more details), 2.7 Å

PDB Description: T7 DNA polymerase in complex with a primer/template DNA containing a disordered N-2 aminofluorene on the template, crystallized with dideoxy-CTP as the incoming nucleotide.

SCOP Domain Sequences for d1x9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9sa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOP Domain Coordinates for d1x9sa1:

Click to download the PDB-style file with coordinates for d1x9sa1.
(The format of our PDB-style files is described here.)

Timeline for d1x9sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x9sa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1x9sb_