Lineage for d1x9fl_ (1x9f L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1976605Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 [116758] (1 species)
  7. 1976606Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116759] (2 PDB entries)
    Uniprot O61233 19-158
  8. 1976609Domain d1x9fl_: 1x9f L: [114994]
    Other proteins in same PDB: d1x9fa_, d1x9fb_, d1x9fc_, d1x9fe_, d1x9ff_, d1x9fg_, d1x9fi_, d1x9fj_, d1x9fk_
    complexed with cmo, hem, po4

Details for d1x9fl_

PDB Entry: 1x9f (more details), 2.6 Å

PDB Description: hemoglobin dodecamer from lumbricus erythrocruorin
PDB Compounds: (L:) Hemoglobin chain d1

SCOPe Domain Sequences for d1x9fl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9fl_ a.1.1.2 (L:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg
ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg
thfdfgawhdcvdqiidgik

SCOPe Domain Coordinates for d1x9fl_:

Click to download the PDB-style file with coordinates for d1x9fl_.
(The format of our PDB-style files is described here.)

Timeline for d1x9fl_: