Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (4 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [88768] (18 PDB entries) |
Domain d1x80a_: 1x80 A: [114950] Other proteins in same PDB: d1x80b1, d1x80b2 complexed with cl, gol, k, mn, tdp |
PDB Entry: 1x80 (more details), 2 Å
SCOP Domain Sequences for d1x80a_:
Sequence, based on SEQRES records: (download)
>d1x80a_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} pqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtl lntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdypl elfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrv vicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgy gimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssayrsvdev nywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsd vyqempaqlrkqqeslarhlqtygehypldhfdk
>d1x80a_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} pqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtl lntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdypl elfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrv vicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgy gimsirvdgndvfavynatkearrravaenqpflieamtyrdhpisrlrhyllsqgwwde eqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqtyge hypldhfdk
Timeline for d1x80a_: