SCOP 1.71: Domain d1wuud2: 1wuu D:217-392

Lineage for d1wuud2 (1wuu D:217-392)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.7: Galactokinase [103011] (1 protein)

6. Protein Galactokinase [103012] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117981] (1 PDB entry)

8. Domain d1wuud2: 1wuu D:217-392 [114907]
   Other proteins in same PDB: d1wuua1, d1wuub1, d1wuuc1, d1wuud1
   complexed with anp, gal, mg

Details for d1wuud2

PDB Entry: 1wuu, 2.5 Å

PDB Description: crystal structure of human galactokinase complexed with mgamppnp and galactose

SCOP Domain Sequences for d1wuud2:

Sequence, based on SEQRES records:

>d1wuud2 d.58.26.7 (D:217-392) Galactokinase {Human (Homo sapiens)}
klavlitnsnvrhslasseypvrrrqceevaralgkeslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

Sequence, based on observed residues (ATOM records):

>d1wuud2 d.58.26.7 (D:217-392) Galactokinase {Human (Homo sapiens)}
klavlitnsnvrhssseypvrrrqceevaralgkeslrevqleeleaardlvskegfrra
rhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgv
ygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

Timeline for d1wuud2:

• d1wuud2 is new in SCOP 1.71
  
• d1wuud2 appears in SCOP 1.73
  
• d1wuud2 appears in the current release, SCOPe 2.08