Lineage for d1wq9b_ (1wq9 B:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623356Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 623357Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 623358Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 623370Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 623411Species Russell's viper (Daboia russelli russelli) [TaxId:8707] [118256] (1 PDB entry)
  8. 623413Domain d1wq9b_: 1wq9 B: [114834]

Details for d1wq9b_

PDB Entry: 1wq9 (more details), 2 Å

PDB Description: crystal structure of vr-1, a vegf-f from a snake venom

SCOP Domain Sequences for d1wq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wq9b_ g.17.1.1 (B:) Vascular endothelial growth factor, VEGF {Russell's viper (Daboia russelli russelli)}
evrpfldvyqrsacqtretlvsilqehpdeisdifrpscvavlrcsgcctdesmkctpvg
khtadiqimrmnprthsskmevmkfmehtacecrpa

SCOP Domain Coordinates for d1wq9b_:

Click to download the PDB-style file with coordinates for d1wq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1wq9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wq9a_