Lineage for d1wpea3 (1wpe A:361-599)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880764Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 880765Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 880766Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 880767Protein Calcium ATPase [81658] (1 species)
  7. 880768Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (15 PDB entries)
    Uniprot P04191
  8. 880785Domain d1wpea3: 1wpe A:361-599 [114804]
    Other proteins in same PDB: d1wpea1, d1wpea2, d1wpea4
    complexed with adp, af3, ca, mg

Details for d1wpea3

PDB Entry: 1wpe (more details), 2.7 Å

PDB Description: Crystal structure of the SR calcium pump with bound aluminium fluoride, ADP and calcium
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d1wpea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpea3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOP Domain Coordinates for d1wpea3:

Click to download the PDB-style file with coordinates for d1wpea3.
(The format of our PDB-style files is described here.)

Timeline for d1wpea3: