Lineage for d1wpea3 (1wpe A:361-599)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616398Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 616399Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 616400Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (3 proteins)
  6. 616401Protein Calcium ATPase [81658] (1 species)
  7. 616402Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (9 PDB entries)
  8. 616412Domain d1wpea3: 1wpe A:361-599 [114804]
    Other proteins in same PDB: d1wpea1, d1wpea2, d1wpea4
    complexed with adp, af3, ca, mg

Details for d1wpea3

PDB Entry: 1wpe (more details), 2.7 Å

PDB Description: crystal structure of the sr calcium pump with bound aluminium fluoride, adp and calcium

SCOP Domain Sequences for d1wpea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpea3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus)}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOP Domain Coordinates for d1wpea3:

Click to download the PDB-style file with coordinates for d1wpea3.
(The format of our PDB-style files is described here.)

Timeline for d1wpea3: