Lineage for d1wnre_ (1wnr E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 797353Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 797354Family b.35.1.1: GroES [50130] (2 proteins)
  6. 797355Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 797436Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493
    Uniprot P61492
    Uniprot P61493 ! Uniprot P61492
  8. 797455Domain d1wnre_: 1wnr E: [114759]

Details for d1wnre_

PDB Entry: 1wnr (more details), 2.9 Å

PDB Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8
PDB Compounds: (E:) 10 kda chaperonin

SCOP Domain Sequences for d1wnre_:

Sequence, based on SEQRES records: (download)

>d1wnre_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
gdivvfakyggteieidgeeyvilserdllavlq

Sequence, based on observed residues (ATOM records): (download)

>d1wnre_ b.35.1.1 (E:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
eyvilserdllavlq

SCOP Domain Coordinates for d1wnre_:

Click to download the PDB-style file with coordinates for d1wnre_.
(The format of our PDB-style files is described here.)

Timeline for d1wnre_: