SCOPe 2.07: Domain d1wnra_: 1wnr A:

Lineage for d1wnra_ (1wnr A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.1: GroES [50130] (2 proteins)
   automatically mapped to Pfam PF00166

6. Protein Chaperonin-10 (GroES) [50131] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
   Uniprot P61493 ! Uniprot P61492

8. Domain d1wnra_: 1wnr A: [114755]

Details for d1wnra_

PDB Entry: 1wnr, 2.9 Å

PDB Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8

PDB Compounds: (A:) 10 kda chaperonin

SCOPe Domain Sequences for d1wnra_:

Sequence, based on SEQRES records:

>d1wnra_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
gdivvfakyggteieidgeeyvilserdllavlq

Sequence, based on observed residues (ATOM records):

>d1wnra_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
eyvilserdllavlq

Timeline for d1wnra_:

• d1wnra_ first appeared in SCOP 1.71
  
• d1wnra_ appears in SCOPe 2.06
  
• d1wnra_ appears in the current release, SCOPe 2.08