Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries) Uniprot P13466 547-857 |
Domain d1wlhb1: 1wlh B:549-647 [114731] |
PDB Entry: 1wlh (more details), 2.8 Å
SCOPe Domain Sequences for d1wlhb1:
Sequence, based on SEQRES records: (download)
>d1wlhb1 b.1.18.10 (B:549-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn gdgtydvefepkeagdyvinltldgdnvngfpktvtvkp
>d1wlhb1 b.1.18.10 (B:549-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} adpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdngdg tydvefepkeagdyvinltldgdnvngfpktvtvkp
Timeline for d1wlhb1: