SCOP 1.71: Domain d1wkia_: 1wki A:

Lineage for d1wkia_ (1wki A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
   Pfam 00252

6. Protein Ribosomal protein L16p [117889] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [117890] (1 PDB entry)

8. Domain d1wkia_: 1wki A: [114725]
   Structural genomics target

Details for d1wkia_

PDB Entry: 1wki

PDB Description: solution structure of ribosomal protein L16 from thermus thermophilus HB8

SCOP Domain Sequences for d1wkia_:

Sequence; same for both SEQRES and ATOM records:

>d1wkia_ d.41.4.2 (A:) Ribosomal protein L16p {Thermotoga maritima}
mlmprrmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrr
ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
aghklpiktkivrrdaydeaq

Timeline for d1wkia_:

• d1wkia_ is new in SCOP 1.71
  
• d1wkia_ appears in SCOP 1.73
  
• d1wkia_ appears in the current release, SCOPe 2.08