![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
![]() | Family d.15.1.2: UBX domain [54250] (5 proteins) Pfam PF00789 |
![]() | Protein Hypothetical protein KIAA0794 [117818] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117819] (1 PDB entry) |
![]() | Domain d1wj4a_: 1wj4 A: [114691] Structural genomics target |
PDB Entry: 1wj4 (more details)
SCOP Domain Sequences for d1wj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} gssgssgtatnhqglpavdseilemppekadgvvegidvngpkaqlmlrypdgkreqitl peqakllalvkhvqskgypnerfelltnfprrklshldyditlqeaglcpqetvfvqesg pssg
Timeline for d1wj4a_: