Lineage for d1wj4a_ (1wj4 A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) 
Family d.15.1.2: UBX domain [54250] (3 proteins)
Pfam 00789
Protein Hypothetical protein KIAA0794 [117818] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117819] (1 PDB entry) 
Domain d1wj4a_: 1wj4 A: [114691]
Structural genomics target
Details for d1wj4a_
PDB Entry: 1wj4 (more details)
PDB Description: solution structure of the ubx domain of kiaa0794 protein
SCOP Domain Sequences for d1wj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens)}
gssgssgtatnhqglpavdseilemppekadgvvegidvngpkaqlmlrypdgkreqitl
peqakllalvkhvqskgypnerfelltnfprrklshldyditlqeaglcpqetvfvqesg
pssg
SCOP Domain Coordinates for d1wj4a_:
Click to download the PDB-style file with coordinates for d1wj4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wj4a_:
- d1wj4a_ is new in SCOP 1.71
- d1wj4a_ appears in SCOP 1.73
- d1wj4a_ appears in the current release, SCOPe 2.08, called d1wj4a1
View in 3D