Lineage for d1wj3a1 (1wj3 A:8-111)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035706Protein Contactin 3 (KIAA1496) [117055] (1 species)
  7. 2035707Species Human (Homo sapiens) [TaxId:9606] [117056] (1 PDB entry)
    Uniprot Q9P232 893-996
  8. 2035708Domain d1wj3a1: 1wj3 A:8-111 [114690]
    Other proteins in same PDB: d1wj3a2, d1wj3a3
    Structural genomics target

Details for d1wj3a1

PDB Entry: 1wj3 (more details)

PDB Description: solution structure of the fourth fn3 domain of kiaa1496 protein
PDB Compounds: (A:) KIAA1496 protein

SCOPe Domain Sequences for d1wj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj3a1 b.1.2.1 (A:8-111) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}
tvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrtssqnnvqv
lntnktsaelvlpikedyiievkattdggdgtsseqiriprits

SCOPe Domain Coordinates for d1wj3a1:

Click to download the PDB-style file with coordinates for d1wj3a1.
(The format of our PDB-style files is described here.)

Timeline for d1wj3a1: