Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Contactin 3 (KIAA1496) [117055] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117056] (1 PDB entry) Uniprot Q9P232 893-996 |
Domain d1wj3a1: 1wj3 A:8-111 [114690] Other proteins in same PDB: d1wj3a2, d1wj3a3 Structural genomics target |
PDB Entry: 1wj3 (more details)
SCOPe Domain Sequences for d1wj3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wj3a1 b.1.2.1 (A:8-111) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} tvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrtssqnnvqv lntnktsaelvlpikedyiievkattdggdgtsseqiriprits
Timeline for d1wj3a1: