SCOP 1.73: Domain d1wj1a_: 1wj1 A:

Lineage for d1wj1a_ (1wj1 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
   Pfam PF00640

6. Protein Numb [50762] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117256] (1 PDB entry)

8. Domain d1wj1a_: 1wj1 A: [114688]
   Structural genomics target

Details for d1wj1a_

PDB Entry: 1wj1

PDB Description: solution structure of phosphotyrosine interaction domain of mouse numb protein

PDB Compounds: (A:) numb protein

SCOP Domain Sequences for d1wj1a_:

Sequence; same for both SEQRES and ATOM records:

>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkk
avkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwich
cfmavkdtgerlshavgcafaaclerkqkrsgpssg

Timeline for d1wj1a_:

• d1wj1a_ first appeared in SCOP 1.71
  
• d1wj1a_ appears in SCOP 1.75
  
• d1wj1a_ appears in the current release, SCOPe 2.08, called d1wj1a1