Lineage for d1wiha_ (1wih A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912596Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912641Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 1912642Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1912643Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1912652Species Mouse (Mus musculus), mitochondrial [TaxId:10090] [118014] (1 PDB entry)
    Uniprot Q9D6S7 116-186
  8. 1912653Domain d1wiha_: 1wih A: [114672]
    Structural genomics target; core domain only

Details for d1wiha_

PDB Entry: 1wih (more details)

PDB Description: Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from mouse cDNA
PDB Compounds: (A:) mitochondrial ribosome recycling factor

SCOPe Domain Sequences for d1wiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiha_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Mouse (Mus musculus), mitochondrial [TaxId: 10090]}
gssgssgldhitvvtadgkvalnqigqismkspqvilvnmasfpectaaaikairesgmn
lnpevegtlirvpipkvtsgpssg

SCOPe Domain Coordinates for d1wiha_:

Click to download the PDB-style file with coordinates for d1wiha_.
(The format of our PDB-style files is described here.)

Timeline for d1wiha_: