SCOPe 2.05: Domain d1wi8a_: 1wi8 A:

Lineage for d1wi8a_ (1wi8 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Eukaryotic translation initiation factor 4B [117973] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117974] (1 PDB entry)
   Uniprot P23588 88-178

8. Domain d1wi8a_: 1wi8 A: [114662]
   Structural genomics target

Details for d1wi8a_

PDB Entry: 1wi8

PDB Description: solution structure of the rna binding domain of eukaryotic initiation factor 4b

PDB Compounds: (A:) Eukaryotic translation initiation factor 4B

SCOPe Domain Sequences for d1wi8a_:

Sequence; same for both SEQRES and ATOM records:

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}
gssgssgsrlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfg
yaefedldsllsalslneeslgnkrirvdvadqaqdkdsgpssg

Timeline for d1wi8a_:

• d1wi8a_ first appeared in SCOP 1.71
  
• d1wi8a_ appears in SCOPe 2.04
  
• d1wi8a_ is called d1wi8a1 in SCOPe 2.06
  
• d1wi8a_ appears in the current release, SCOPe 2.08, called d1wi8a1