Lineage for d1wi5a_ (1wi5 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125406Protein S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) [117200] (1 species)
  7. 1125407Species Human (Homo sapiens) [TaxId:9606] [117201] (1 PDB entry)
    Uniprot Q14690 173-278
  8. 1125408Domain d1wi5a_: 1wi5 A: [114661]
    Structural genomics target

Details for d1wi5a_

PDB Entry: 1wi5 (more details)

PDB Description: Solution structure of the S1 RNA binding domain from human hypothetical protein BAA11502
PDB Compounds: (A:) RRP5 protein homolog

SCOPe Domain Sequences for d1wi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgknvnrvlsaealkpgmlltgtvssledhgylvdigvdgtraflpllkaqeyir
qknkgaklkvgqylncivekvkgnggvvslsvghsevstaiateqqswnlnnlsgpssg

SCOPe Domain Coordinates for d1wi5a_:

Click to download the PDB-style file with coordinates for d1wi5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wi5a_: