Lineage for d1wi5a_ (1wi5 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800152Protein S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) [117200] (1 species)
  7. 800153Species Human (Homo sapiens) [TaxId:9606] [117201] (1 PDB entry)
    Uniprot Q14690 173-278
  8. 800154Domain d1wi5a_: 1wi5 A: [114661]
    Structural genomics target

Details for d1wi5a_

PDB Entry: 1wi5 (more details)

PDB Description: solution structure of the s1 rna binding domain from human hypothetical protein baa11502
PDB Compounds: (A:) RRP5 protein homolog

SCOP Domain Sequences for d1wi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgknvnrvlsaealkpgmlltgtvssledhgylvdigvdgtraflpllkaqeyir
qknkgaklkvgqylncivekvkgnggvvslsvghsevstaiateqqswnlnnlsgpssg

SCOP Domain Coordinates for d1wi5a_:

Click to download the PDB-style file with coordinates for d1wi5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wi5a_: