Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins) barrel, closed; n=5, S=8 |
Protein S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) [117200] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117201] (1 PDB entry) Uniprot Q14690 173-278 |
Domain d1wi5a_: 1wi5 A: [114661] Structural genomics target |
PDB Entry: 1wi5 (more details)
SCOP Domain Sequences for d1wi5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} gssgssgknvnrvlsaealkpgmlltgtvssledhgylvdigvdgtraflpllkaqeyir qknkgaklkvgqylncivekvkgnggvvslsvghsevstaiateqqswnlnnlsgpssg
Timeline for d1wi5a_: