SCOP 1.71: Domain d1wi0a_: 1wi0 A:

Lineage for d1wi0a_ (1wi0 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (8 proteins)
   Pfam 00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117828] (1 PDB entry)

8. Domain d1wi0a_: 1wi0 A: [114657]
   Structural genomics target

Details for d1wi0a_

PDB Entry: 1wi0

PDB Description: solution structure of the pb1 domain of mouse mitogen activated protein kinase kinase 5 (map2k5)

SCOP Domain Sequences for d1wi0a_:

Sequence; same for both SEQRES and ATOM records:

>d1wi0a_ d.15.2.2 (A:) Mitogen activated protein kinase kinase 5, Map2k5 {Mouse (Mus musculus)}
gssgssgpfcamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttaf
eyededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifprsgpssg

Timeline for d1wi0a_:

• d1wi0a_ is new in SCOP 1.71
  
• d1wi0a_ appears in SCOP 1.73
  
• d1wi0a_ appears in the current release, SCOPe 2.08, called d1wi0a1