Lineage for d1whxa_ (1whx A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603934Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 603935Family d.58.7.1: Canonical RBD [54929] (32 proteins)
  6. 604056Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)
  7. 604057Species Mouse (Mus musculus) [TaxId:10090] [117970] (2 PDB entries)
  8. 604059Domain d1whxa_: 1whx A: [114654]
    Structural genomics target; 4th RBD

Details for d1whxa_

PDB Entry: 1whx (more details)

PDB Description: Solution structure of the second RNA binding domain from hypothetical protein BAB23448

SCOP Domain Sequences for d1whxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus)}
gssgssgrsktvilaknlpagtlaaeiqetfsrfgslgrvllpeggitaivefleplear
kafrhlayskfhhvplylewapigvfgaapqkkdsqheqpaekaesgpssg

SCOP Domain Coordinates for d1whxa_:

Click to download the PDB-style file with coordinates for d1whxa_.
(The format of our PDB-style files is described here.)

Timeline for d1whxa_: