Lineage for d1whva_ (1whv A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862240Protein Poly(A)-specific ribonuclease PARN [117967] (1 species)
  7. 862241Species Mouse (Mus musculus) [TaxId:10090] [117968] (1 PDB entry)
    Uniprot Q8VDG3 430-516; structure of the R3H domain (162-248) is also known ((111031))
  8. 862242Domain d1whva_: 1whv A: [114652]
    Structural genomics target

Details for d1whva_

PDB Entry: 1whv (more details)

PDB Description: solution structure of the rna binding domain from hypothetical protein bab23382
PDB Compounds: (A:) Poly(A)-specific Ribonuclease

SCOP Domain Sequences for d1whva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}
gssgssggpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpe
qvqiavntskyaesyriqtyaeyvgkkqkgkqvksgpssg

SCOP Domain Coordinates for d1whva_:

Click to download the PDB-style file with coordinates for d1whva_.
(The format of our PDB-style files is described here.)

Timeline for d1whva_: